Specialty Answering Service
iPhone + Android
7.1No. 5 of 35
in Virtual Receptionist Services
in Virtual Receptionist Services
- Recognised40% of the score20
- Phone app26% of the score100
- Documented20% of the score97
- Free plan14% of the score0
- Free plan
- Trial only
- Paid plans from
- $44/mo
- Runs on
- Android, iPhone, Web
Summary
Specialty Answering Service is ranked #5 of 35 in virtual receptionist services on Samsung Mobile US Press. It runs on Android, iOS, Web. There is no free plan. A free trial is offered. Paid plans start at $44/mo.
Specialty Answering Service plans and pricing
All plansEconomy $44/mo $44 per month + $1.54 per minute Per-minute billing · billed by the second specialtyansweringservice.net · 3 Oct 2026
100 Minute $159/mo $159 per month + $1.44 each additional minute 100 minutes included · billed by the second specialtyansweringservice.net · 3 Oct 2026
220 Minute $269/mo $269 per month + $1.44 each additional minute 220 minutes included · billed by the second specialtyansweringservice.net · 3 Oct 2026
500 Minute $649/mo $649 per month + $1.34 each additional minute 500 minutes included · billed by the second specialtyansweringservice.net · 3 Oct 2026
1,000 Minute $1,199/mo $1199 per month + $1.29 each additional minute 1,000 minutes included · billed by the second specialtyansweringservice.net · 3 Oct 2026
2,500 Minute $2,929/mo $2929 per month + $1.19 each additional minute 2,500 minutes included · billed by the second specialtyansweringservice.net · 3 Oct 2026
Compared on virtual receptionist services
- Free plan
- Nospecialtyansweringservice.net
- Paid from
- $44/mospecialtyansweringservice.net
- Answering mode
- humanspecialtyansweringservice.net
- Call qualification
- Yesspecialtyansweringservice.net
- Message taking
- Yesspecialtyansweringservice.net
- Call routing
- Yesspecialtyansweringservice.net
- Appointment scheduling
- Yesspecialtyansweringservice.net
- Multilingual answering
- Yesspecialtyansweringservice.net
Facts
- Service
- The company provides 24-hour live answering, message taking, and call transfer services for businesses.specialtyansweringservice.net · 3 Oct 2026
- Call handling
- Accounts can use customized call scripts and call routing, including cold and warm transfers.specialtyansweringservice.net · 3 Oct 2026
- Dispatch
- After an operator ends a call, the system can dispatch the message by text, email, or both.specialtyansweringservice.net · 3 Oct 2026
- Mobile app
- The iPhone and Android app supports listening to calls, updating status, running reports, and texting callers.specialtyansweringservice.net · 3 Oct 2026
- Integrations
- SAS Flex lists integrations including Salesforce, HubSpot, Google Calendar, Zendesk, Zoho, and Zapier.support.specialtyansweringservice.net · 3 Oct 2026
- Custom integration
- The Custom Action app can send call data to a software endpoint URL using a webhook.support.specialtyansweringservice.net · 3 Oct 2026
- Security
- The company states its call center is SOC 2 certified and PCI and HIPAA compliant, and says portal access is controlled by user privileges.support.specialtyansweringservice.net · 3 Oct 2026
- Healthcare
- The company says it can sign a Business Associate Agreement and describes HIPAA compliant call handling for medical practices.specialtyansweringservice.net · 3 Oct 2026
- Support
- The company offers phone, email, social media, and live chat support.specialtyansweringservice.net · 3 Oct 2026
- Trial terms
- The pricing page says the free trial provides access to operators and software for two weeks or 200 minutes without a credit card.specialtyansweringservice.net · 3 Oct 2026
- Plan flexibility
- The company says plans are billed monthly, have no long-term contract, and can be changed or canceled at any time.specialtyansweringservice.net · 3 Oct 2026
- Company history
- The company says it was founded in 1985 in the Philadelphia suburbs and lists its address in King of Prussia, Pennsylvania.specialtyansweringservice.net · 3 Oct 2026
Company
- Founded
- 1985specialtyansweringservice.net · 28 Sept 2026
- Headquarters
- King of Prussia, Pennsylvania, United Statesspecialtyansweringservice.net · 28 Sept 2026
Best Specialty Answering Service alternatives
See all 12
Where it ranks on Samsung Mobile US Press
Is Specialty Answering Service yours?
Claim it for free: prove the domain, then correct facts, plans and screenshots. An editor reviews every change.
Sources
- specialtyansweringservice.net/about/· checked 3 Oct 2026
- specialtyansweringservice.net/features/· checked 3 Oct 2026
- support.specialtyansweringservice.net/article/524-sas-flex-app-integrations· checked 3 Oct 2026
- support.specialtyansweringservice.net/article/368-post-message-data-to-webhoo· checked 3 Oct 2026
- support.specialtyansweringservice.net/article/58-are-my-messages-secure· checked 3 Oct 2026
- specialtyansweringservice.net/industries/healthcare/hipaa-compliant-a· checked 3 Oct 2026
- specialtyansweringservice.net/pricing/· checked 3 Oct 2026
- specialtyansweringservice.net· checked 28 Sept 2026